BTD Polyclonal AntibodyBTD Polyclonal Antibody
Move your mouse over image or click to enlarge

BTD Polyclonal Antibody

Cat# Size Price Qty Buy
A13955-200ul 200ul
£332.50
A13955-100ul 100ul
£192.50
A13955-50ul 50ul
£113.75
A13955-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13955
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names BTD; biotinidase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 284-543 of human BTD (NP_000051.1).
Reactivity Human, Mouse, Rat
Gene ID 686
Calculated MW 58kDa/61kDa
Observed MW 65-70kDa
Physical Appearance liquid
Purification Affinity purification
Sequence IQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSKFLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMYDNFTLVPVWGKEGYLHVCSNGLCCYLLYERPTLSKELYALGVFDGLHTVHGTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSYIFPLFLTSGMTLEVPDQLGWENDHYFLRKSRLSSGLVTAALYGRLYERD
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents