BSG Polyclonal AntibodyBSG Polyclonal Antibody
Move your mouse over image or click to enlarge

BSG Polyclonal Antibody

Cat# Size Price Qty Buy
A13954-200ul 200ul
£332.50
A13954-100ul 100ul
£192.50
A13954-50ul 50ul
£113.75
A13954-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13954
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names BSG; 5F7; CD147; EMMPRIN; OK; TCSF; basigin
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 45-200 of human BSG (NP_940991.1).
Reactivity Human, Mouse, Rat
Gene ID 682
Calculated MW 19kDa/22kDa/29kDa/42kDa
Observed MW 52-55kDa
Physical Appearance liquid
Purification Affinity purification
Sequence DSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITL
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents