BRAF Polyclonal AntibodyBRAF Polyclonal Antibody
Move your mouse over image or click to enlarge

BRAF Polyclonal Antibody

Cat# Size Price Qty Buy
A13953-200ul 200ul
£332.50
A13953-100ul 100ul
£192.50
A13953-50ul 50ul
£113.75
A13953-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13953
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names BRAF; B-RAF1; B-raf; BRAF1; NS7; RAFB1; serine/threonine-protein kinase B-raf
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 350-449 of human BRAF (NP_004324.2).
Reactivity Human, Mouse
Gene ID 673
Calculated MW 84kDa
Observed MW 84kDa
Physical Appearance liquid
Purification Affinity purification
Sequence DEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSSDD
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents