BOLA3 Polyclonal AntibodyBOLA3 Polyclonal Antibody
Move your mouse over image or click to enlarge

BOLA3 Polyclonal Antibody

Cat# Size Price Qty Buy
A15985-20ul 20ul
£77.00
A15985-50ul 50ul
£113.75
A15985-100ul 100ul
£192.50
A15985-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15985
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names BOLA3; MMDS2; bolA-like protein 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-68 of human BOLA3 (NP_997717.2).
Reactivity Mouse, Rat
Gene ID 388962
Calculated MW 11kDa/12kDa
Observed MW 12kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAAWSPAAAAPLLRGIRGLPLHHRMFATQTEGELRVTQILKEKFPRATAIKVTDISGGCGAMYEIKIE
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents