BMI1 Polyclonal AntibodyBMI1 Polyclonal Antibody
Move your mouse over image or click to enlarge

BMI1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13472-200ul 200ul
£332.50
A13472-100ul 100ul
£192.50
A13472-50ul 50ul
£113.75
A13472-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13472
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names BMI1; FLVI2/BMI1; PCGF4; RNF51; flvi-2/bmi-1; polycomb complex protein BMI-1
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-326 of human BMI1 (NP_005171.4).
Reactivity Human, Mouse
Gene ID 648
Calculated MW 36kDa
Observed MW 41kDa
Physical Appearance liquid
Purification Affinity purification
Sequence EDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents