BLOC1S6 Polyclonal AntibodyBLOC1S6 Polyclonal Antibody
Move your mouse over image or click to enlarge

BLOC1S6 Polyclonal Antibody

Cat# Size Price Qty Buy
A4620-200ul 200ul
£332.50
A4620-100ul 100ul
£192.50
A4620-50ul 50ul
£113.75
A4620-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4620
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names BLOC1S6; BLOS6; HPS9; PA; PALLID; PLDN; biogenesis of lysosomal organelles complex 1 subunit 6
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human BLOC1S6 (NP_036520.1).
Reactivity Human, Mouse, Rat
Gene ID 26258
Calculated MW 8kDa/19kDa
Observed MW 20kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAK
Sensitivity WB,1:200 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents