BLOC1S1 Polyclonal AntibodyBLOC1S1 Polyclonal Antibody
Move your mouse over image or click to enlarge

BLOC1S1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13986-200ul 200ul
£332.50
A13986-100ul 100ul
£192.50
A13986-50ul 50ul
£113.75
A13986-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13986
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names BLOC1S1; BLOS1; BORCS1; GCN5L1; MICoA; RT14; biogenesis of lysosomal organelles complex 1 subunit 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-153 of human BLOC1S1 (NP_001478.2).
Reactivity Human, Mouse
Gene ID 2647
Calculated MW 14kDa/17kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents