BFSP1 Polyclonal AntibodyBFSP1 Polyclonal Antibody
Move your mouse over image or click to enlarge

BFSP1 Polyclonal Antibody

Cat# Size Price Qty Buy
A3764-200ul 200ul
£332.50
A3764-100ul 100ul
£192.50
A3764-50ul 50ul
£113.75
A3764-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3764
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names BFSP1; CP115; CP94; CTRCT33; LIFL-H; filensin
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 281-540 of human BFSP1 (NP_001155177.1).
Reactivity Human, Mouse, Rat
Gene ID 631
Calculated MW 58kDa/60kDa/74kDa
Observed MW 110kDa
Physical Appearance liquid
Purification Affinity purification
Sequence EESESKFESESKEVSPLTQEGAPEDVPDGGQISKGFGKLYRKVKEKVRSPKEPETPTELYTKERHVLVTGDANYVDPRFYVSSITAKGGVAVSVAEDSVLYDGQVEPSPESPKPPLENGQVGLQEKEDGQPIDQQPIDKEIEPDGAELEGPEEKREGEERDEESRRPCAMVTPGAEEPSIPEPPKPAADQDGAEVLGTRSRSLPEKGPPKALAYKTVEVVESIEKISTESIQTYEETAVIVETMIGKTKSDKKKSGEKSS
Sensitivity WB,1:1000 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents