BEST1 Polyclonal AntibodyBEST1 Polyclonal Antibody
Move your mouse over image or click to enlarge

BEST1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14070-200ul 200ul
£332.50
A14070-100ul 100ul
£192.50
A14070-50ul 50ul
£113.75
A14070-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14070
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names BEST1; ARB; BEST; BMD; RP50; TU15B; VMD2; bestrophin-1
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 376-585 of human BEST1 (NP_004174.1).
Reactivity Human, Mouse
Gene ID 7439
Calculated MW 57kDa/67kDa/69kDa
Observed MW 68kDa
Physical Appearance liquid
Purification Affinity purification
Sequence QPNQEDEEDAHAGIIGRFLGLQSHDHHPPRANSRTKLLWPKRESLLHEGLPKNHKAAKQNVRGQEDNKAWKLKAVDAFKSAPLYQRPGYYSAPQTPLSPTPMFFPLEPSAPSKLHSVTGIDTKDKSLKTVSSGAKKSFELLSESDGALMEHPEVSQVRRKTVEFNLTDMPEIPENHLKEPLEQSPTNIHTTLKDHMDPYWALENRDEAHS
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents