BCL2L14 Polyclonal AntibodyBCL2L14 Polyclonal Antibody
Move your mouse over image or click to enlarge

BCL2L14 Polyclonal Antibody

Cat# Size Price Qty Buy
A14148-200ul 200ul
£332.50
A14148-100ul 100ul
£192.50
A14148-50ul 50ul
£113.75
A14148-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14148
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names BCL2L14; BCLG; BCL2 like 14
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-327 of human BCL2L14 (NP_620049.1).
Reactivity Human, Mouse
Gene ID 79370
Calculated MW 28kDa/30kDa/36kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents