BBS4 Polyclonal AntibodyBBS4 Polyclonal Antibody
Move your mouse over image or click to enlarge

BBS4 Polyclonal Antibody

Cat# Size Price Qty Buy
A3759-200ul 200ul
£332.50
A3759-100ul 100ul
£192.50
A3759-50ul 50ul
£113.75
A3759-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3759
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names BBS4; Bardet-Biedl syndrome 4
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 350-519 of human BBS4 (NP_149017.2).
Reactivity Human
Gene ID 585
Calculated MW 38kDa/58kDa/59kDa
Observed MW 53kDa
Physical Appearance liquid
Purification Affinity purification
Sequence NLEDIENAKRAYAEAVHLDKCNPLVNLNYAVLLYNQGEKKNALAQYQEMEKKVSLLKDNSSLEFDSEMVEMAQKLGAALQVGEALVWTKPVKDPKSKHQTTSTSKPASFQQPLGSNQALGQAMSSAAAYRTLPSGAGGTSQFTKPPSLPLEPEPAVESSPTETSEQIREK
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents