BANF1 Polyclonal AntibodyBANF1 Polyclonal Antibody
Move your mouse over image or click to enlarge

BANF1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14555-200ul 200ul
£332.50
A14555-100ul 100ul
£192.50
A14555-50ul 50ul
£113.75
A14555-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14555
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names BANF1; BAF; BCRP1; D14S1460; NGPS; barrier-to-autointegration factor
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-89 of human BANF1 (NP_001137457.1).
Reactivity Human, Mouse, Rat
Gene ID 8815
Calculated MW 10kDa
Observed MW 10kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents