BAD Polyclonal AntibodyBAD Polyclonal Antibody
Move your mouse over image or click to enlarge

BAD Polyclonal Antibody

Cat# Size Price Qty Buy
A1593-20ul 20ul
£77.00
A1593-50ul 50ul
£113.75
A1593-100ul 100ul
£192.50
A1593-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A1593
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names BAD; BBC2; BCL2L8; bcl2-associated agonist of cell death
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 110 to the C-terminus of human BAD (NP_004313.1).
Reactivity Human, Mouse, Rat
Gene ID 572
Calculated MW 18kDa
Observed MW 15kDa
Physical Appearance liquid
Purification Affinity purification
Sequence YGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:10 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents