B3GNT4 Polyclonal AntibodyB3GNT4 Polyclonal Antibody
Move your mouse over image or click to enlarge

B3GNT4 Polyclonal Antibody

Cat# Size Price Qty Buy
A15896-20ul 20ul
£77.00
A15896-50ul 50ul
£113.75
A15896-100ul 100ul
£192.50
A15896-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15896
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names B3GNT4; B3GN-T4; beta3Gn-T4; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 165-305 of human B3GNT4 (NP_110392.1).
Reactivity Mouse, Rat
Gene ID 79369
Calculated MW 39kDa/42kDa
Observed MW 42kDa
Physical Appearance liquid
Purification Affinity purification
Sequence APPAQLLAYESREFDDILQWDFTEDFFNLTLKELHLQRWVVAACPQAHFMLKGDDDVFVHVPNVLEFLDGWDPAQDLLVGDVIRQALPNRNTKVKYFIPPSMYRATHYPPYAGGGGYVMSRATVRRLQAIMEDAELFPIDD
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents