AZU1 Polyclonal AntibodyAZU1 Polyclonal Antibody
Move your mouse over image or click to enlarge

AZU1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13952-200ul 200ul
£332.50
A13952-100ul 100ul
£192.50
A13952-50ul 50ul
£113.75
A13952-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13952
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names AZU1; AZAMP; AZU; CAP37; HBP; HUMAZUR; NAZC; hHBP; azurocidin
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 27-251 of human AZU1 (NP_001691.1).
Reactivity Human, Mouse, Rat
Gene ID 566
Calculated MW 26kDa
Observed MW 27kDa
Physical Appearance liquid
Purification Affinity purification
Sequence IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGPGPA
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents