AXIN2 Polyclonal AntibodyAXIN2 Polyclonal Antibody
Move your mouse over image or click to enlarge

AXIN2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13373-200ul 200ul
£332.50
A13373-100ul 100ul
£192.50
A13373-50ul 50ul
£113.75
A13373-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13373
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names AXIN2; AXIL; ODCRCS; axin-2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human AXIN2 (NP_004646.3).
Reactivity Human
Gene ID 8313
Calculated MW 93kDa
Observed MW Refer to Figures
Physical Appearance liquid
Purification Affinity purification
Sequence MSSAMLVTCLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKGQVTKPMPVSSNTRRNEDGLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQMNLKDTKTLRV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents