ATR Polyclonal AntibodyATR Polyclonal Antibody
Move your mouse over image or click to enlarge

ATR Polyclonal Antibody

Cat# Size Price Qty Buy
A13951-200ul 200ul
£332.50
A13951-100ul 100ul
£192.50
A13951-50ul 50ul
£113.75
A13951-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13951
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ATR; FCTCS; FRP1; MEC1; SCKL; SCKL1; ATR serine/threonine kinase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 400-650 of human ATR (NP_001175.2).
Reactivity Mouse
Gene ID 545
Calculated MW 294kDa/297kDa/301kDa
Observed MW 316kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LKMESMEIIEEIQCQTQQENLSSNSDGISPKRRRLSSSLNPSKRAPKQTEEIKHVDMNQKSILWSALKQKAESLQISLEYSGLKNPVIEMLEGIAVVLQLTALCTVHCSHQNMNCRTFKDCQHKSKKKPSVVITWMSLDFYTKVLKSCRSLLESVQKLDLEATIDKVVKIYDALIYMQVNSSFEDHILEDLCGMLSLPWIYSHSDDGCLKLTTFAANLLTLSCRISDSYSPQAQSRCVFLLTLFPRRIFLE
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents