ATPAF2 Polyclonal AntibodyATPAF2 Polyclonal Antibody
Move your mouse over image or click to enlarge

ATPAF2 Polyclonal Antibody

Cat# Size Price Qty Buy
A15928-20ul 20ul
£77.00
A15928-50ul 50ul
£113.75
A15928-100ul 100ul
£192.50
A15928-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15928
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ATPAF2; ATP12; ATP12p; LP3663; MC5DN1; ATP synthase mitochondrial F1 complex assembly factor 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 41-200 of human ATPAF2 (NP_663729.1).
Reactivity Mouse
Gene ID 91647
Calculated MW 32kDa
Observed MW 38kDa
Physical Appearance liquid
Purification Affinity purification
Sequence APPTERKRFYQNVSITQGEGGFEINLDHRKLKTPQAKLFTVPSEALAIAVATEWDSQQDTIKYYTMHLTTLCNTSLDNPTQRNKDQLIRAAVKFLDTDTICYRVEEPETLVELQRNEWDPIIEWAEKRYGVEISSSTSIMGPSIPAKTREVLVSHLASYN
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents