ATP6V1G3 Polyclonal AntibodyATP6V1G3 Polyclonal Antibody
Move your mouse over image or click to enlarge

ATP6V1G3 Polyclonal Antibody

Cat# Size Price Qty Buy
A14443-200ul 200ul
£332.50
A14443-100ul 100ul
£192.50
A14443-50ul 50ul
£113.75
A14443-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14443
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ATP6V1G3; ATP6G3; Vma10; V-type proton ATPase subunit G 3
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human ATP6V1G3 (NP_573569.1).
Reactivity Mouse
Gene ID 127124
Calculated MW 6kDa/13kDa/14kDa
Observed MW 14kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents