ATP6V1E1 Polyclonal AntibodyATP6V1E1 Polyclonal Antibody
Move your mouse over image or click to enlarge

ATP6V1E1 Polyclonal Antibody

Cat# Size Price Qty Buy
A3756-200ul 200ul
£332.50
A3756-100ul 100ul
£192.50
A3756-50ul 50ul
£113.75
A3756-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3756
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ATP6V1E1; ATP6E; ATP6E2; ATP6V1E; P31; Vma4; ARCL2C; V-type proton ATPase subunit E 1
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 77-226 of human ATP6V1E1 (NP_001687.1).
Reactivity Human, Mouse, Rat
Gene ID 529
Calculated MW 22kDa/23kDa/26kDa
Observed MW 35kDa
Physical Appearance liquid
Purification Affinity purification
Sequence NQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD
Sensitivity WB,1:1000 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents