ATP5H Polyclonal AntibodyATP5H Polyclonal Antibody
Move your mouse over image or click to enlarge

ATP5H Polyclonal Antibody

Cat# Size Price Qty Buy
A4425-200ul 200ul
£332.50
A4425-100ul 100ul
£192.50
A4425-50ul 50ul
£113.75
A4425-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4425
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ATP5H; ATPQ; ATP synthase subunit d, mitochondrial
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-161 of human ATP5H (NP_006347.1).
Reactivity Human, Monkey, Mouse, Rat
Gene ID 10476
Calculated MW 15kDa/18kDa
Observed MW 18kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents