ATP1A3 Polyclonal AntibodyATP1A3 Polyclonal Antibody
Move your mouse over image or click to enlarge

ATP1A3 Polyclonal Antibody

Cat# Size Price Qty Buy
A16036-20ul 20ul
£77.00
A16036-50ul 50ul
£113.75
A16036-100ul 100ul
£192.50
A16036-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16036
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ATP1A3; AHC2; ATP1A1; CAPOS; DYT12; RDP; ATPase Na+/K+ transporting subunit alpha 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human ATP1A3 (NP_689509.1).
Reactivity Mouse, Rat
Gene ID 478
Calculated MW 111kDa/113kDa
Observed MW 112kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MGDKKDDKDSPKKNKGKERRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQE
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents