ATP1A2 Polyclonal AntibodyATP1A2 Polyclonal Antibody
Move your mouse over image or click to enlarge

ATP1A2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13805-200ul 200ul
£332.50
A13805-100ul 100ul
£192.50
A13805-50ul 50ul
£113.75
A13805-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13805
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ATP1A2; FHM2; MHP2; ATPase Na+/K+ transporting subunit alpha 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human ATP1A2 (NP_000693.1).
Reactivity Human, Mouse, Rat
Gene ID 477
Calculated MW 112kDa
Observed MW 112kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKGLTNQRAQDVL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents