ATP10A Polyclonal AntibodyATP10A Polyclonal Antibody
Move your mouse over image or click to enlarge

ATP10A Polyclonal Antibody

Cat# Size Price Qty Buy
A15873-20ul 20ul
£77.00
A15873-50ul 50ul
£113.75
A15873-100ul 100ul
£192.50
A15873-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15873
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ATP10A; ATP10C; ATPVA; ATPVC; probable phospholipid-transporting ATPase VA
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 440-690 of human ATP10A (NP_077816.1).
Reactivity Human
Gene ID 57194
Calculated MW 17kDa/167kDa
Observed MW 170kDa
Physical Appearance liquid
Purification Affinity purification
Sequence RRCTVSGVEYSHDANAQRLARYQEADSEEEEVVPRGGSVSQRGSIGSHQSVRVVHRTQSTKSHRRTGSRAEAKRASMLSKHTAFSSPMEKDITPDPKLLEKVSECDKSLAVARHQEHLLAHLSPELSDVFDFFIALTICNTVVVTSPDQPRTKVRVRFELKSPVKTIEDFLRRFTPSCLTSGCSSIGSLAANKSSHKLGSSFPSTPSSDGMLLRLEERLGQPTSAIASNGYSSQADNWASELAQEQESERE
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents