ATL2 Polyclonal AntibodyATL2 Polyclonal Antibody
Move your mouse over image or click to enlarge

ATL2 Polyclonal Antibody

Cat# Size Price Qty Buy
A15884-20ul 20ul
£77.00
A15884-50ul 50ul
£113.75
A15884-100ul 100ul
£192.50
A15884-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15884
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ATL2; ARL3IP2; ARL6IP2; aip-2; atlastin2; atlastin-2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 390-470 of human ATL2 (NP_001129145.1).
Reactivity Human, Mouse, Rat
Gene ID 64225
Calculated MW 46kDa/64kDa/65kDa/66kDa
Observed MW 66kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ARDTYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFY
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents