ATG4B Polyclonal AntibodyATG4B Polyclonal Antibody
Move your mouse over image or click to enlarge

ATG4B Polyclonal Antibody

Cat# Size Price Qty Buy
A14112-200ul 200ul
£332.50
A14112-100ul 100ul
£192.50
A14112-50ul 50ul
£113.75
A14112-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14112
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ATG4B; APG4B; AUTL1; cysteine protease ATG4B
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-393 of human ATG4B (NP_037457.3).
Reactivity Human, Rat
Gene ID 23192
Calculated MW 31kDa/37kDa/42kDa/44kDa/52kDa
Observed MW 44kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSDRHCNGFPAGAEVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPTDGCFIPDESFHCQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents