ATG16L1 Polyclonal AntibodyATG16L1 Polyclonal Antibody
Move your mouse over image or click to enlarge

ATG16L1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14138-200ul 200ul
£332.50
A14138-100ul 100ul
£192.50
A14138-50ul 50ul
£113.75
A14138-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14138
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ATG16L1; APG16L; ATG16A; ATG16L; IBD10; WDR30; autophagy related 16 like 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ATG16L1 (NP_110430.5).
Reactivity Human, Mouse
Gene ID 55054
Calculated MW 47kDa/49kDa/53kDa/66kDa/68kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence QEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDT
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents