ATF3 Polyclonal AntibodyATF3 Polyclonal Antibody
Move your mouse over image or click to enlarge

ATF3 Polyclonal Antibody

Cat# Size Price Qty Buy
A13470-200ul 200ul
£332.50
A13470-100ul 100ul
£192.50
A13470-50ul 50ul
£113.75
A13470-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13470
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ATF3; activating transcription factor 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human ATF3 (NP_001665.1).
Reactivity Human, Mouse
Gene ID 467
Calculated MW 12kDa/13kDa/14kDa/15kDa/20kDa
Observed MW 21kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents