ASNS Polyclonal AntibodyASNS Polyclonal Antibody
Move your mouse over image or click to enlarge

ASNS Polyclonal Antibody

Cat# Size Price Qty Buy
A16035-20ul 20ul
£77.00
A16035-50ul 50ul
£113.75
A16035-100ul 100ul
£192.50
A16035-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16035
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ASNS; ASNSD; TS11; asparagine synthetase [glutamine-hydrolyzing]
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 262-561 of human ASNS (NP_597680.2).
Reactivity Human, Mouse, Rat
Gene ID 440
Calculated MW 54kDa/62kDa/64kDa
Observed MW 55, 64kDa
Physical Appearance liquid
Purification Affinity purification
Sequence DSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSARTLTHYKSAVKA
Sensitivity WB,1:500 - 1:2000|IHC,1:100 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents