ASK1 Polyclonal AntibodyASK1 Polyclonal Antibody
Move your mouse over image or click to enlarge

ASK1 Polyclonal Antibody

Cat# Size Price Qty Buy
A3271-200ul 200ul
£332.50
A3271-100ul 100ul
£192.50
A3271-50ul 50ul
£113.75
A3271-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3271
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MAP3K5; ASK1; MAPKKK5; MEKK5; mitogen-activated protein kinase kinase kinase 5
Applications IHC
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1173-1374 of human ASK1 (NP_005914.1).
Reactivity Human, Rat
Gene ID 4217
Calculated MW 69kDa/154kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ELRPHFSLASESDTADQEDLDVEDDHEEQPSNQTVRRPQAVIEDAVATSGVSTLSSTVSHDSQSAHRSLNVQLGRMKIETNRLLEELVRKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT
Sensitivity IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents