ASIP Polyclonal AntibodyASIP Polyclonal Antibody
Move your mouse over image or click to enlarge

ASIP Polyclonal Antibody

Cat# Size Price Qty Buy
A13280-200ul 200ul
£332.50
A13280-100ul 100ul
£192.50
A13280-50ul 50ul
£113.75
A13280-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13280
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ASIP; AGSW; AGTI; AGTIL; ASP; SHEP9; agouti-signaling protein
Applications IF
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-132 of human ASIP (NP_001663.2).
Reactivity Human
Gene ID 434
Calculated MW 14kDa
Physical Appearance liquid
Purification Affinity purification
Sequence HLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRKAAEKKRSSKKEASMKKVVRPRTPLSAPCVATRNSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC
Sensitivity IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents