ASH2L Polyclonal AntibodyASH2L Polyclonal Antibody
Move your mouse over image or click to enlarge

ASH2L Polyclonal Antibody

Cat# Size Price Qty Buy
A14543-200ul 200ul
£332.50
A14543-100ul 100ul
£192.50
A14543-50ul 50ul
£113.75
A14543-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14543
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ASH2L; ASH2; ASH2L1; ASH2L2; Bre2; set1/Ash2 histone methyltransferase complex subunit ASH2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 81-280 of human ASH2L (NP_001098684.1).
Reactivity Human
Gene ID 9070
Calculated MW 56kDa/60kDa/68kDa
Observed MW 69kDa
Physical Appearance liquid
Purification Affinity purification
Sequence NLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYR
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents