ASGR2 Polyclonal AntibodyASGR2 Polyclonal Antibody
Move your mouse over image or click to enlarge

ASGR2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13949-200ul 200ul
£332.50
A13949-100ul 100ul
£192.50
A13949-50ul 50ul
£113.75
A13949-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13949
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ASGR2; ASGP-R2; ASGPR2; CLEC4H2; HBXBP; HL-2; asialoglycoprotein receptor 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 131-287 of human ASGR2 (NP_550435.1).
Reactivity Mouse, Rat
Gene ID 433
Calculated MW 32kDa/35kDa
Observed MW 38kDa
Physical Appearance liquid
Purification Affinity purification
Sequence VDLRFVACQMELLHSNGSQRTCCPVNWVEHQGSCYWFSHSGKAWAEAEKYCQLENAHLVVINSWEEQKFIVQHTNPFNTWIGLTDSDGSWKWVDGTDYRHNYKNWAVTQPDNWHGHELGGSEDCVEVQPDGRWNDDFCLQVYRWVCEKRRNATGEVA
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents