ASCL4 Polyclonal AntibodyASCL4 Polyclonal Antibody
Move your mouse over image or click to enlarge

ASCL4 Polyclonal Antibody

Cat# Size Price Qty Buy
A14439-200ul 200ul
£332.50
A14439-100ul 100ul
£192.50
A14439-50ul 50ul
£113.75
A14439-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14439
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ASCL4; HASH4; bHLHa44; achaete-scute homolog 4
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-172 of human ASCL4 (NP_982260.2).
Reactivity Human, Rat
Gene ID 121549
Calculated MW 19kDa
Observed MW 19kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MMETRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRVALRLDAACWEWARSGCARGWQYLPVPLDSAFEPAFLRKRNERERQRVRCVNEGYARLRDHLPRELADKRLSKVETLRAAIDYIKHLQELLERQAWGLEGAAGAVPQRRAECNSDGESKASSAPSPSSEPEEGG
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents