ASB13 Polyclonal AntibodyASB13 Polyclonal Antibody
Move your mouse over image or click to enlarge

ASB13 Polyclonal Antibody

Cat# Size Price Qty Buy
A15897-20ul 20ul
£77.00
A15897-50ul 50ul
£113.75
A15897-100ul 100ul
£192.50
A15897-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15897
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ASB13; ankyrin repeat and SOCS box protein 13
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 179-278 of human ASB13 (NP_078977.2).
Reactivity Mouse
Gene ID 79754
Calculated MW 18kDa/30kDa
Observed MW 30kDa
Physical Appearance liquid
Purification Affinity purification
Sequence AKLHETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPLTLSQLCRVNLRKATGVRGLEKIAKLNIPPRLIDYLSYN
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents