ASAH1 Polyclonal AntibodyASAH1 Polyclonal Antibody
Move your mouse over image or click to enlarge

ASAH1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13948-200ul 200ul
£332.50
A13948-100ul 100ul
£192.50
A13948-50ul 50ul
£113.75
A13948-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13948
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ASAH1; AC; ACDase; ASAH; PHP; PHP32; SMAPME; acid ceramidase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 140-389 of human ASAH1 (NP_001120977.1).
Reactivity Human, Mouse, Rat
Gene ID 427
Calculated MW 44kDa/46kDa
Observed MW 45kDa
Physical Appearance liquid
Purification Affinity purification
Sequence IVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFSINGGYLGILEWILGKKDVMWIGFLTRTVLENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQFETYLRDCPDPCIGW
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents