ARSB Polyclonal AntibodyARSB Polyclonal Antibody
Move your mouse over image or click to enlarge

ARSB Polyclonal Antibody

Cat# Size Price Qty Buy
A14231-200ul 200ul
£332.50
A14231-100ul 100ul
£192.50
A14231-50ul 50ul
£113.75
A14231-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14231
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ARSB; ASB; G4S; MPS6; arylsulfatase B
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 404-533 of human ARSB (NP_000037.2).
Reactivity Human
Gene ID 411
Calculated MW 45kDa/59kDa
Observed MW 60kDa
Physical Appearance liquid
Purification Affinity purification
Sequence PCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents