ARMC6 Polyclonal AntibodyARMC6 Polyclonal Antibody
Move your mouse over image or click to enlarge

ARMC6 Polyclonal Antibody

Cat# Size Price Qty Buy
A15931-20ul 20ul
£77.00
A15931-50ul 50ul
£113.75
A15931-100ul 100ul
£192.50
A15931-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15931
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ARMC6; R30923_1; armadillo repeat containing 6
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human ARMC6 (NP_001186125.1).
Reactivity Human, Mouse, Rat
Gene ID 93436
Calculated MW 51kDa/54kDa
Observed MW 54kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSERCCSRYSSGASIGCTPTSTQAKMVSKRIAQETFDAAVRENIEEFAMGPEEAVKEAVEQFESQGVDLSNIVKTAPKVSADGSQEPTHDILQMLSDLQESVASSRPQEVSAYLTRFCDQCKQDKACRFLAAQKGAYPIIFTAWKLATAGDQGLLLQSLNALSVLTDGQPDLLDAQGLQLLVATLTQNADEADLTCSGIRCVRHACLKHEQNRQDLVKAG
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents