ARHGDIA Polyclonal AntibodyARHGDIA Polyclonal Antibody
Move your mouse over image or click to enlarge

ARHGDIA Polyclonal Antibody

Cat# Size Price Qty Buy
A13468-200ul 200ul
£332.50
A13468-100ul 100ul
£192.50
A13468-50ul 50ul
£113.75
A13468-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13468
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ARHGDIA; GDIA1; HEL-S-47e; NPHS8; RHOGDI; RHOGDI-1; rho GDP-dissociation inhibitor 1
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-204 of human ARHGDIA (NP_001172006.1).
Reactivity Human, Mouse, Rat
Gene ID 396
Calculated MW 18kDa/23kDa
Observed MW 23kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents