ARF5 Polyclonal AntibodyARF5 Polyclonal Antibody
Move your mouse over image or click to enlarge

ARF5 Polyclonal Antibody

Cat# Size Price Qty Buy
A3737-200ul 200ul
£332.50
A3737-100ul 100ul
£192.50
A3737-50ul 50ul
£113.75
A3737-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3737
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ARF5; ADP-ribosylation factor 5
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human ARF5 (NP_001653.1).
Reactivity Human, Mouse, Rat
Gene ID 381
Calculated MW 20kDa
Observed MW 16kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR
Sensitivity WB,1:1000 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents