AQP5 Polyclonal AntibodyAQP5 Polyclonal Antibody
Move your mouse over image or click to enlarge

AQP5 Polyclonal Antibody

Cat# Size Price Qty Buy
A13861-200ul 200ul
£332.50
A13861-100ul 100ul
£192.50
A13861-50ul 50ul
£113.75
A13861-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13861
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names AQP5; AQP-5; PPKB; aquaporin-5
Applications IHC
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human AQP5 (NP_001642.1).
Reactivity Mouse
Gene ID 362
Calculated MW 28kDa
Physical Appearance liquid
Purification Affinity purification
Sequence TDSRRTSPVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFGPAVVMNRFSPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDEDWE
Sensitivity IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents