APRT Polyclonal AntibodyAPRT Polyclonal Antibody
Move your mouse over image or click to enlarge

APRT Polyclonal Antibody

Cat# Size Price Qty Buy
A13946-200ul 200ul
£332.50
A13946-100ul 100ul
£192.50
A13946-50ul 50ul
£113.75
A13946-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13946
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names APRT; AMP; APRTD; adenine phosphoribosyltransferase
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human APRT (NP_000476.1).
Reactivity Human, Mouse, Rat
Gene ID 353
Calculated MW 14kDa/19kDa
Observed MW 19-22kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents