ANXA5 Polyclonal AntibodyANXA5 Polyclonal Antibody
Move your mouse over image or click to enlarge

ANXA5 Polyclonal Antibody

Cat# Size Price Qty Buy
A13945-200ul 200ul
£332.50
A13945-100ul 100ul
£192.50
A13945-50ul 50ul
£113.75
A13945-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13945
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ANXA5; ANX5; ENX2; HEL-S-7; PP4; RPRGL3; annexin A5
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-320 of human ANXA5 (NP_001145.1).
Reactivity Human, Mouse
Gene ID 308
Calculated MW 35kDa
Observed MW 36kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents