ANT1/ANT2/ANT3/ANT4 Polyclonal AntibodyANT1/ANT2/ANT3/ANT4 Polyclonal Antibody
Move your mouse over image or click to enlarge

ANT1/ANT2/ANT3/ANT4 Polyclonal Antibody

Cat# Size Price Qty Buy
A15988-50ul 50ul
£113.75
A15988-20ul 20ul
£77.00
A15988-200ul 200ul
£332.50
A15988-100ul 100ul
£192.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15988
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human ANT1 (NP_001142.2).
Reactivity Mouse, Rat
Gene ID 291/292/293/83447
Calculated MW 33kDa/32kDa/35kDa
Observed MW 25kDa
Physical Appearance liquid
Purification Affinity purification
Sequence GMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents