ANGPTL4 Polyclonal AntibodyANGPTL4 Polyclonal Antibody
Move your mouse over image or click to enlarge

ANGPTL4 Polyclonal Antibody

Cat# Size Price Qty Buy
A13425-200ul 200ul
£332.50
A13425-100ul 100ul
£192.50
A13425-50ul 50ul
£113.75
A13425-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13425
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ANGPTL4; ARP4; FIAF; HARP; HFARP; NL2; PGAR; TGQTL; UNQ171; pp1158; angiopoietin like 4
Applications IF
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 26-406 of human ANGPTL4 (NP_647475.1).
Reactivity Human
Gene ID 51129
Calculated MW 26kDa/40kDa/45kDa
Physical Appearance liquid
Purification Affinity purification
Sequence GPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS
Sensitivity IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents