AMY1A Polyclonal AntibodyAMY1A Polyclonal Antibody
Move your mouse over image or click to enlarge

AMY1A Polyclonal Antibody

Cat# Size Price Qty Buy
A13276-200ul 200ul
£332.50
A13276-100ul 100ul
£192.50
A13276-50ul 50ul
£113.75
A13276-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13276
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names AMY1A; AMY1; alpha-amylase 1
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 16-200 of human AMY1A (NP_004029.2).
Reactivity Mouse
Gene ID 276
Calculated MW 57kDa
Observed MW 54kDa
Physical Appearance liquid
Purification Affinity purification
Sequence QYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNH
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents