AMPD1 Polyclonal AntibodyAMPD1 Polyclonal Antibody
Move your mouse over image or click to enlarge

AMPD1 Polyclonal Antibody

Cat# Size Price Qty Buy
A3584-200ul 200ul
£332.50
A3584-100ul 100ul
£192.50
A3584-50ul 50ul
£113.75
A3584-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3584
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names AMPD1; MAD; MADA; MMDD; AMP deaminase 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-260 of human AMPD1 (NP_001166097.1).
Reactivity Human, Mouse, Rat
Gene ID 270
Calculated MW 89kDa/90kDa
Observed MW 80kDa
Physical Appearance liquid
Purification Affinity purification
Sequence AEKVFASEVKDEGGRQEISPFDVDEICPISHHEMQAHIFHLETLSTSTEARRKKRFQGRKTVNLSIPLSETSSTKLSHIDEYISSSPTYQTVPDFQRVQITGDYASGVTVEDFEIVCKGLYRALCIREKYMQKSFQRFPKTPSKYLRNIDGEAWVANESFYPVFTPPVKKGEDPFRTDNLPENLGYHLKMKDGVVYVYPNEAAVSKDEPKP
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents