ALKBH1 Polyclonal AntibodyALKBH1 Polyclonal Antibody
Move your mouse over image or click to enlarge

ALKBH1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14079-200ul 200ul
£332.50
A14079-100ul 100ul
£192.50
A14079-50ul 50ul
£113.75
A14079-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14079
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ALKBH1; ABH; ABH1; ALKBH; alkB; hABH; nucleic acid dioxygenase ALKBH1
Applications IF, IP, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 110-389 of human ALKBH1 (NP_006011.2).
Reactivity Human
Gene ID 8846
Calculated MW 43kDa
Observed MW 44kDa
Physical Appearance liquid
Purification Affinity purification
Sequence YQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQSKEFLRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLSEQVAAACGFEDFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSGFSRLLNHAVPRVLPNPEGEGLPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARINPDS
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200|IP,1:20 - 1:50
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents