ALDH6A1 Polyclonal AntibodyALDH6A1 Polyclonal Antibody
Move your mouse over image or click to enlarge

ALDH6A1 Polyclonal Antibody

Cat# Size Price Qty Buy
A3309-200ul 200ul
£332.50
A3309-100ul 100ul
£192.50
A3309-50ul 50ul
£113.75
A3309-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3309
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ALDH6A1; MMSADHA; MMSDH; aldehyde dehydrogenase 6 family member A1
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 326-535 of human ALDH6A1 (NP_005580.1).
Reactivity Human, Mouse, Rat
Gene ID 4329
Calculated MW 56kDa/57kDa
Observed MW 58kDa
Physical Appearance liquid
Purification Affinity purification
Sequence VGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLITPQAKERVCNLIDSGTKEGASILLDGRKIKVKGYENGNFVGPTIISNVKPNMTCYKEEIFGPVLVVLETETLDEAIQIVNNNPYGNGTAIFTTNGATARKYAHLVDVGQVGVNVPIPVPLPMFSFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQWKEEDATLSSPAVVMPTMGR
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents