ALDH5A1 Polyclonal AntibodyALDH5A1 Polyclonal Antibody
Move your mouse over image or click to enlarge

ALDH5A1 Polyclonal Antibody

Cat# Size Price Qty Buy
A16074-20ul 20ul
£77.00
A16074-50ul 50ul
£113.75
A16074-100ul 100ul
£192.50
A16074-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16074
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ALDH5A1; SSADH; SSDH; aldehyde dehydrogenase 5 family member A1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human ALDH5A1 (NP_001071.1).
Reactivity Human, Mouse, Rat
Gene ID 7915
Calculated MW 57kDa/58kDa
Observed MW 57kDa
Physical Appearance liquid
Purification Affinity purification
Sequence VSKGATVVTGGKRHQLGKNFFEPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents